PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn156111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 165aa    MW: 18647.4 Da    PI: 6.9019
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn156111genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26091.11.3e-28121111100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaC+++r++C++ C+l++yfp+++++ f  vhkl+G +n lk++ ++p +  ++++++l++eA++r + Pv G++++   ++ ++++ ++el+++k+
  Achn156111  12 ACAACRHQRKRCEPYCPLRKYFPSNKEEVFLSVHKLYGLNNFLKIIGSVPFHLEHKTAQTLIFEAKVRSQFPVLGSLELQAWIKARIMECEKELEVVKK 110
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  Achn156111 111 E 111
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.37211112IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-2712109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MQGGGVNINA VACAACRHQR KRCEPYCPLR KYFPSNKEEV FLSVHKLYGL NNFLKIIGSV  60
PFHLEHKTAQ TLIFEAKVRS QFPVLGSLEL QAWIKARIME CEKELEVVKK ELAVQEEKKK  120
SQDTIETNLT LGTNFELKSR GKQPMVCDDD NNEEEMEGEA TSSN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28661752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.15e-17LOB domain-containing protein 2